PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0984s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 433aa    MW: 48307.4 Da    PI: 6.1679
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0984s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.41e-073704032154
                             HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             k +yp++e++++L +++gL+ +q+ +WF N+R +
  SapurV1A.0984s0020.1.p 370 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 403
                             469*****************************87 PP

2ELK28.82.8e-10324345122
                     ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                             ELKh+L+++Y+++++++++E++
  SapurV1A.0984s0020.1.p 324 ELKHELKQGYKEKIVDIREEIL 345
                             9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012559.3E-20157201IPR005540KNOX1
PfamPF037902.6E-17159200IPR005540KNOX1
SMARTSM012561.2E-27212267IPR005541KNOX2
PfamPF037917.4E-20218266IPR005541KNOX2
SMARTSM011886.1E-4324345IPR005539ELK domain
PfamPF037891.0E-6324345IPR005539ELK domain
PROSITE profilePS512139.969324344IPR005539ELK domain
PROSITE profilePS5007111.661344407IPR001356Homeobox domain
SMARTSM003893.8E-11346411IPR001356Homeobox domain
SuperFamilySSF466894.71E-16346410IPR009057Homeodomain-like
CDDcd000862.02E-11347408No hitNo description
Gene3DG3DSA:1.10.10.604.3E-25351408IPR009057Homeodomain-like
PfamPF059201.2E-17364403IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MAFHHNLSSQ DLPLHHFTDQ QATENNTAPP NWLNTALLRS QQQQQQQRTH HHFTDNNTNN  60
FLNLHSATPS TTAATSDSTS HNPTQWLSRS SSSLLHRNHS NVIDDVAAAT TGGDHPIIAS  120
MSQESSELKN MNKSEGETMV AESGGGGGES VVNWQNARYK ADILAHPLYD QLLSAHVACL  180
RIATPVDQLP RIDAQLAQSQ QVVAKYSALG SQQGLVPDDK ELDQFMTHYF LLLCSFKEQL  240
QQHVRVHAME AVMACWEIEQ SLQSLTGVSP GEGTGATMSD DDEDQVDSDA NLFDGSLEGA  300
DTMGFGPLVP TESERSLMER VRQELKHELK QGYKEKIVDI REEILRKRRA GKLPGDTTSV  360
LKAWWQSHSK WPYPTEEDKA RLVQETGLQL KQINNWFINQ RKRNWHTNPS SSTVLKSKRK  420
SNAGDNNGEQ FV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A3e-12347411872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7700200.0KP770020.1 Populus tomentosa TALE transcription factor (Potri.006G259400) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011039618.10.0PREDICTED: homeobox protein knotted-1-like 4 isoform X2
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A0F6V0900.0A0A0F6V090_POPTO; TALE transcription factor
STRINGPOPTR_0018s02210.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.10.0KNOTTED1-like homeobox gene 3